PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g10880.4
Common NameLR48_Vigan07g201600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ZF-HD
Protein Properties Length: 170aa    MW: 18752.2 Da    PI: 9.833
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g10880.4genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer41.63e-131312960
     ZF-HD_dimer 29 mpsegeegtaaalkCaACgCHRnFHRreveee 60
                    mp+ ge+gt +a+ CaAC+CHRnFHR+e + e
  Vang01g10880.4  1 MPA-GEDGTLEAVICAACNCHRNFHRKEIDGE 31
                    566.888********************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-10134IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152311.849127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.0E-11128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.18E-2193167IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-3297168IPR009057Homeodomain-like
TIGRFAMsTIGR015651.9E-25106163IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MPAGEDGTLE AVICAACNCH RNFHRKEIDG EMTSFHHRAQ PPPPLHHHHQ FSPYYHHRVP  60
QHPGAGGYLH HHLATPPMAQ HRPLALPAAA SGGGLSSGGG GGGGSKKRFR TKFTQEQKDK  120
MLAFAEQVGW RIQKHDESAV EQFCAETNVE RKVLKVWMHN NKNTLGKKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-301051641675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-157AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014503688.11e-102PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ6YXH53e-53ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A0L9V0B61e-104A0A0L9V0B6_PHAAN; Uncharacterized protein
STRINGGLYMA14G35770.12e-92(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-45homeobox protein 22
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]